1. Impulse!'s parent company, ABC-Paramount Records, was established in 1955 as the recording division of the American Broadcasting Company (ABC).

ABC Records startete im Jahre 1955 unter dem Namen ABC-Paramount Records, dem Schallplattenlabel der Am-Par Record Corporation (eine Tochterfirma von "American Broadcasting-Paramount Theaters, Inc"), gegründet in New York City im Jahre 1955.

2. As always, the scan is available for your enjoyment in the "Amiga In ABC.

Wie immer, der Scan für Ihren Genuss in der zur Verfügung "Amiga In ABC.

3. All store purchases will show up on your credit card as ABC Dildos, incorporated.

Alle Ladeneinkäufe werden auf ihrer Kreditkarte als ABC Dildos GmbH angezeigt.

4. An American Broadcasting Company (ABC) affiliate, KXLY-TV is translated as K09DG in Omak.

Eine ABC-Tochter, KXLY-TV wird in Omak als K09DG ausgestrahlt.

5. Also in 2011, Shaw appeared as Lisa in the ABC Family original film Teen Spirit.

Außerdem erschien Shaw 2011 als Lisa in dem ABC Family Original Movie Teen Spirit.

6. Acid Black Cherry (abbreviated as ABC) is the solo project of the former lead vocalist of Janne Da Arc, Yasu.

Acid Black Cherry (kurz A.B.C.) ist ein Soloprojekt des japanischen Sängers Yasu (Janne Da Arc).

7. In 1962 he became the first Black network news correspondent for ABC television network as a United Nations (UN) reporter.

1962 wurde er der erste afroamerikanische Nachrichten-Korrespondent des ABC-TV-Netzwerkes und arbeitete zunächst als UNO-Reporter.

8. ABC of Anarchism.

ABC des Anarchismus.

9. My ABC book!

Meine ABC-Fibel!

10. It's an ABC wound.

Das ist eine ABC Wunde.

11. ABIS II offers the highest standards in terms of suitability for industrial applications as well as expandability, defect detection and easy use.

ABIS II vereint höchste Maßstäbe in Bezug auf Industrietauglichkeit, Erweiterbarkeit, Fehlerdetektion und einfache Bedienung. Für eine Messung wählt der Bediener lediglich am Touchscreen das zu prüfende Bauteil aus und startet den Prüfablauf.

12. The incorporation of an innovative TAP control interface makes adjusting settings and reviewing shots as easy as the tap of a finger.

Mit der neuen TAP Control-Funktion reagiert sie selbst auf leichtes Antippen mit dem Finger - ideal dann, wenn Handschuhe getragen werden.

13. Wahlworts with only three letters occasionally appeared in the code, such as ABC or XXX, but also very long compounds, such as Donaudampfschiffahrtsgesellschaftskapitän (Danube steamboating association captain) or Hottentottenpotentatentantenattentäter (Hottentot potentate aunt assassin ).

In der Praxis kamen auch gelegentlich Wahlwörter nur der Länge drei vor wie ABC oder XXX, aber auch sehr lange Wortungetüme wie DONAUDAMPFSQIFFAHRTSGESELLSQAFTSKAPITAEN oder HOTTENTOTENPOTENTATENTANTENATTENTAETER.

14. Displays with Automatic Brightness Control (ABC)

Displays mit automatischer Helligkeitsregelung (ABC)

15. It is not easy to accept that this process can function, as we know it often does.

Es ist nicht leicht, einzusehen, warum das so funktionieren kann, wie es das bekanntlich so oft tut.

16. That big book is an ABC book.

Ein Schüler braucht eine ABC-Fibel.

17. A moment ago that said ABC News.

Aber gerade eben stand da noch " ABC News ".

18. The exhibition also explains the history of money, as well as the technologically advanced security features, which make the banknotes difficult to forge, but counterfeits easy to recognise

Diese Merkmale, dank derer es sehr schwierig ist, Banknoten zu fälschen, jedoch leicht, Fälschungen zu erkennen, entsprechen den höchsten technologischen Standards

19. ABC analysis is frequently combined with Pareto analysis.

Dabei wird sie oftmals mit der ABC-Analyse verbunden.

20. To make the abbreviations easy to understand, SLO-LA and SLR-LA are designated as IL8LA and GAPLA, respectively.

Um die Abkürzungen leicht verständlich zu machen, wenden SLO-LA und SLR-LA als IL8LA bzw. GAPLA bezeichnet.

21. - permit easy access via PSTN, PSS, Videotex terminals, telex and other forms of direct access such as via ISDN;

- Möglichkeit des problemlosen Zugangs über PSTN, PSS, Bildschirmtext, Telex und sonstige Formen des direkten Zugriffs, z. B. über ISDN;

22. Point 23: Definition of "'Automated Border Control' (ABC)

Nummer 23: „automatisierte Grenzkontrolle“

23. One of the exporting producers, ABC Chemicals Co.

Für einen der ausführenden Hersteller, nämlich ABC Chemicals Co.

24. I got some ABC-type information for you, lady.

Ich werde Ihnen mal was sagen, Lady.

25. ABC analysis is used in SAP NetWeaver Business Intelligence.

Die ABC-Analyse wird in SAP NetWeaver Business Intelligence verwendet.

26. That will be no easy task, as we have many different opinions, but these negotiations and this dialogue are absolutely necessary.

Das wird nicht leicht sein, weil wir viele unterschiedliche Auffassungen haben, aber diese Verhandlungen und dieser Dialog sind absolut notwendig.

27. It is the same material as the bricks themselves, only it is fresh adobe that is soft and easy to manage.

Dabei handelt es sich um das gleiche Material, aus dem die Ziegel hergestellt sind, nur ist es frischer, plastischer Lehm, der leicht zu verarbeiten ist.

28. Indicator that is assigned by the procedure of ABC analysis.

Kennzeichen, das gemäß der ABC-Analyse für Objekte vergeben wird.

29. In addition, such a way of communicating would make it easy to represent a hypothesis as a fact which it is not.

Hinzu kommt, dass es durch eine derartige Kommunikation leichtfällt, Hypothesen entgegen ihrer Natur als Tatsache darzustellen.

30. RABC is the On Mode percent power reduction due to ABC,

RABC ist die durch die automatische Helligkeitsregelung (ABC) bewirkte prozentuale Verringerung der Leistungsaufnahme im Ein-Zustand.

31. As krill tend to aggregate in concentrated swarms, they are easy to catch and have become particularly attractive to large-scale commercial interests.

Da der Krill sich in konzentrierten Schwärmen ansammelt, ist er leicht zu fangen und daher besonders für die kommerzielle Nutzung im großen Umfang interessant.

32. Within easy access of the hotel are a variety of entertainments, such as the amusement park Tusenfryd (approximately 1 km from the hotel).

Vom Hotel aus haben Sie leichten Zugang zu verschiedenen Unterhaltungsmöglichkeiten wie dem Vergnügungspark Tusenfryd (ca. 1 km vom Hotel entfernt).

33. The fracture type is described by the AO comprehensive ABC classification.

Die Fraktur-Klassifikation erfolgt nach der ABC-Einteilung vonMaurice Müller.

34. At week # the proportion of subjects with HIV RNA < # copies/ml were # %, # % and # % for the ZDV/#TC/ABC, ZDV/#TC/EFV and ZDV/#TC/ABC/EFV arms, respectively

Nach # Wochen betrug die Quote der Patienten mit einer HIV-RNA von &lt; # Kopien/ml # %, # % und # % in den Armen mit ZDV/#TC/ABC, ZDV/#TC/EFV und ZDV/#TC/ABC/EFV

35. RST is the consecutive number of the substance in the series ABC

RST: die laufende Nummer des Stoffes in der ABC-Reihe

36. Due to the ABC analysis the GC for each speciality was specified.

Für diese idealtypische Annahme beträgt der GK 0,86.

37. - RST is the consecutive number of the substance in the series ABC,

- RST: die laufende Nummer des Stoffes in der ABC-Reihe,

38. Prior notification of a concentration (Case M.9324 — ALSO/ABC Data) ( 1 )

Vorherige Anmeldung eines Zusammenschlusses (Sache M.9324 — ALSO/ABC Data) ( 1 )

39. K-ABC-Number Recall is a valid instrument for children with APD.

Das K-ABC ZN wird den Anforderungen an seine konvergente Validität für Kinder mit AVWS gut gerecht.

40. In August 2012 Shinichi Mochizuki claimed a proof of the abc conjecture.

2012: Shinichi Mochizuki hat möglicherweise die abc-Vermutung bewiesen.

41. ABC then asked her to do a movie based on the book.

Daraufhin bat ihn die ABC-Filmproduktion, das Stück mit der Bühnen-Besetzung zu verfilmen.

42. RST is the consecutive number of the substance in the series ABC;

RST: laufende Nummer des Stoffes in der ABC-Reihe;

43. In addition to the above its easy access to other locations has helped mark it as an ideal holiday destination for foreigners and Greeks alike.

An diesem Punkt beschlossen wir, dieses wunderschöne Haus zu bauen mit viel Lust, Geschmack und Liebe zum Detail Der ganze Bau ist neu, vom Fundament bis zum Dach, was allerdings nur ein geübtes Auge bemerken wird. Denn es ist ganz im traditionellen Stil des Dorfes errichtet, mit seinem unregelmäßigen Putz, der an manchen stellen abzubröckeln scheint und die Natursteine der Mauer sehen lässt, dem Holzfußboden, den Möblierung lassen es mind.

44. Measured on mode power at 100 lux ambient light at the ABC sensor

Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 100 Lux am ABC-Sensor

45. TAGs with three different fatty acids (ABC, here OLLn, PLLn, PoOLn, PPoLn) (9)

TAG mit drei unterschiedlichen Fettsäuren (ABC, hier OLLn, PLLn, PoOLn, PPoLn) (9)

46. Meeting codes are in the form abc-nmop-xyz (the dashes are optional).

Besprechungscodes sind nach dem Muster abc-nmop-xyz formatiert (Bindestriche optional).

47. " If only I had a child as white as snow as red as blood... "

" Wenn ich nur ein Kind hätte, so weiß wie Schnee, so rot wie Blut und so schwarz wie Ebenholz. "

48. Measured on mode power at 12 lux ambient light at the ABC sensor

Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 12 Lux am ABC-Sensor

49. The measured screen luminance at 60 lux ambient light at the ABC sensor

Gemessene Bildschirmluminanz des bei einem Umgebungslicht von 60 Lux am ABC-Sensor

50. Create complex reports and ABC-analysis about your customers and products, simple and fast.

Erstellen Sie einfach komplexe Reports und ABC-Analysen über Ihre Kunden und Produkte.

51. Nevertheless, we have developed a small glossary for you: from ABC-Analysis to WinCATI.

Dennoch haben wir ein kleines Lexikon für Sie entwickelt: Von der ABC-Analyse zur Zufriedenheit.

52. This paper introduces a land suitability analysis, based on the Dutch “ABC location planning”.

In diesem Beitrag wird eine adaptierte Form der niederländischen ABC-Standortplanung als Methode der Baulandpotenzialanalyse diskutiert.

53. Noise is not as black as oil, or as acrid as chemical waste; yet it is just as harmful, in condensed form.

Lärm hat nicht die schwarze Farbe von Schweröl, nicht den beißenden Geruch von chemischen Emissionen, doch weist er die gleiche Schädlichkeit auf.

54. allocated capacity as soon as possible after each allocation, as well as an indication of prices paid;

möglichst bald nach jeder Vergabe die zugewiesene Kapazität und Angaben zu den gezahlten Preisen

55. After all, as a doctor, you're just as capable as I am.

Sie sind ein ebenso guter Arzt wie ich.

56. You perform an ABC analysis to classify objects according to specific criteria or performance measures.

Die ABC-Analyse dient zur Klassifizierung von Objekten nach bestimmten Kriterien oder Kennzahlen.

57. Those statistics also show that Chinese imports are now mainly entering the Union via ABC.

Die entsprechenden Statistiken zeigen auch, dass die Einfuhren aus der VR China mittlerweile hauptsächlich über ABC in die Union gelangen.

58. (Broadcast on ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.

(Hörspiel für das ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.

59. RST is the consecutive number of the substances referred to in the sub-sequence ABC ;

RST laufende Nummer der Verbindungen des unter ABC aufgeführten Elements ;

60. He began by assuming, that in triangle ABC, angle A and B are both obtuse.

Zuerst hat er angenommen, dass im Dreieck ABC die Winkel bei A und B beide stumpfwinkelig sind.

61. A linguist as well as an adventuress.

Linguistin und Abenteurerin?

62. He is as baffled as we are.

Er ist genauso verblüfft wie wir.

63. This hotel is situated in the heart of Athens close to the Acropolis, the main shopping area and within easy reach of many attractions such as museums and galleries.

Das Hotel liegt im Herzen von Athen in der Nähe der Akropolis, dem Haupteinkaufsviertel und vieler Attraktionen, z.B. Museen und Galerien. Alle wichtigen Sehenswürdigkeiten erreichen Sie bequem zu...

64. Only medium.. scrape easy.

Nur mittel.. Kratzen einfach.

65. The Allometric Biomass and Carbon (ABC) factors database inventories carbon stock gathered from National Forest Inventories.

Die Datenbank zu allometrischen Biomasse- und Kohlenstofffaktoren inventarisiert den Kohlenstoffgehalt aus nationalen Forstbeständen.

66. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes.

Die Mitglieder der ABCA Subfamilie bilden die einzige ABC Subfamilie, die ausschließlich in multizellulären Eukaryoten gebildet werden.

67. A chain of lies as strong as steel.

Eine Verkettung von Lügen, so hart wie Stahl.

68. Purpose: Previous studies indicated that ATP-binding cassette (ABC) membrane transporters protect against UV-induced apoptosis.

Hintergrund: In früheren Studien konnte gezeigt werden, dass Mitglieder der Familie der ABC-(„ATP-binding cassette“-)Membrantransporter gegen UV-induzierte Apoptose schützen können.

69. As far as the horns of the altar.

Bis an die Hörner des Altars.

70. The protection of human health and the environment primarily considered for the safe ABC product development.

Der Schutz der menschlichen Gesundheit und der Umwelt stehen im Mittelpunkt einer sicheren ABC Produktentwicklung.

71. The disclosed mirror systems may be designed as objective lenses, as magnifying or diminishing projection lenses, as afocal systems, as collimators and as real or virtual point light sources.

Erfindungsgemäße Spiegelsysteme sind als Objektive; als vergrößernde oder verkleinernde Projektive; als afokale Systeme; als Kollimatoren und als reelle oder virtuelle Punktlichtquellen ausbildbar.

72. “Saint Pancras Brought Good Luck to Madrid” was the headline in the Spanish weekly ABC, international edition.

„Der heilige Pankratius hat Madrid Glück gebracht“, lautete eine Überschrift in der internationalen Ausgabe der spanischen Wochenzeitung ABC.

73. But the aftereffect from her is as bitter as wormwood; it is as sharp as a two-edged sword.” —Proverbs 5:3, 4.

Aber die Nachwirkung von ihr ist so bitter wie Wermut; sie ist so scharf wie ein zweischneidiges Schwert“ (Sprüche 5:3, 4).

74. Two fully adjustable cock rings. Lets you go as tight or as loose as you like.

Zwei voll einstellbare Penisringe die für eine härtere und längere Erektion sorgen.

75. Teachers rated the latch-key children as being as well adjusted socially as the other children.

Lehrer stellten fest, daß die soziale Anpassung bei Schlüsselkindern genauso gut ist wie bei anderen Kindern.

76. The methodology developed is based on ABC analysis and is presented in detail in this academic work.

Die entwickelte Methodik ist an eine ABC-Analyse angelehnt und wird in dieser wissenschaftlichen Arbeit genauer dargestellt.

77. It was about this time that I received a call from the American Broadcasting Company, ABC television.

Ungefähr um diese Zeit bekam ich von der Fernsehgesellschaft American Broadcasting Company einen Anruf.

78. Allergology and biotechnological diagnostics, as well as food analysis

Allergologie und der biotechnologischen Diagnostik sowie Lebensmittelanalytik

79. We welcome organised groups, as well as individual anglers.

Man soll Sandwiches etwas zum Trinken am besten eine Thermosflasche mit heißem Kaffee oder Tee mitnehmen.

80. Move the struts as far apart as we can.

Streben so weit wie möglich auseinander.